PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009780702.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 355aa    MW: 38306.4 Da    PI: 9.7042
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009780702.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.18e-3871131363
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                     e+ +kcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalr vPvGgg+r+nk+sss
  XP_009780702.1  71 EAVQKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRSSS 131
                     56789****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3254123IPR003851Zinc finger, Dof-type
PfamPF027019.5E-3273128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.99474128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MVFSSISAYL DPANWQQQAG HSIPNPQFQS VQPPRPLAAP PPVQTYVGGG GTIRPGSMAD  60
RARLANIPMA EAVQKCPRCE STNTKFCYFN NYSLSQPRHF CKTCRRYWTR GGALRSVPVG  120
GGCRRNKRSS SSTKATNNNN NTPKSPGSST STGGCRQIAT NSGSTSNNNN SFSSPSSAAS  180
LLGLMSPQIH HPLRFMSPLG QLTDHHFTPN NDNNITMNYS AISSSSAPVA GTNENMSFQL  240
GMGGNLEQWR LQQQVANQFP NFYGGLDSSS ASGLYPFHPA YYTSNDAGGV TVTSSQIRPK  300
ITNPMLTQLA LMKMEDNHEH SSLSRQFVGN ENWSNGSAWN ELSASFSSSS TSNAL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780702.10.0PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_016473568.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLK4D4761e-135K4D476_SOLLC; Uncharacterized protein
STRINGSolyc10g086440.1.11e-135(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.18e-45DNA binding with one finger 2.4